DTX3L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85340-2-RR (same clone as 85340-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85340-2-RR (DTX3L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85340-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85340-2-RR (same clone as 85340-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85340-2-RR (DTX3L antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85340-2-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 85340-2-RR (same clone as 85340-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using DTX3L antibody (85340-2-RR, Clone: 242627C8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85340-2-PBS in a different storage buffer formulation.

DTX3L Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85340-2-PBS

Clone No.242627C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242627C8, BBAP, B-lymphoma- and BAL-associated protein, deltex 3 like (Drosophila), E3 ubiquitin-protein ligase DTX3L

---

Product Information

85340-2-PBS targets DTX3L in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2568

  Product name: Recombinant human DTX3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-741 aa of BC060509

  Sequence: SVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE

• Full Name: deltex 3-like (Drosophila)
• Calculated Molecular Weight: 740 aa, 84 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC060509
• Gene Symbol: DTX3L
• Gene ID (NCBI): 151636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.