DTX4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DTX4 Polyclonal antibody, PBS Only (25222-1-PBS)

• 

  WB analysis of mouse kidney using 25222-1-AP (same clone as 25222-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25222-1-AP (DTX4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 25222-1-AP (same clone as 25222-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25222-1-AP (DTX4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25222-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse embryo using 25222-1-AP (same clone as 25222-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse embryo tissue using 25222-1-AP (DTX4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25222-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 25222-1-AP (same clone as 25222-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 25222-1-AP (DTX4 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25222-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DTX4 Polyclonal Antibody for WB, IF/ICC, IF-P, Indirect ELISA

Cat No. 25222-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IF-P, Indirect ELISA

Synonyms

deltex homolog 4 (Drosophila), Deltex4, E3 ubiquitin-protein ligase DTX4, EC:2.3.2.27, KIAA0937

---

Product Information

25222-1-PBS targets DTX4 in WB, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18415

  Product name: Recombinant human DTX4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 51-213 aa of BC119011

  Sequence: LDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVK

• Full Name: deltex homolog 4 (Drosophila)
• Calculated Molecular Weight: 619 aa, 67 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC119011
• Gene Symbol: DTX4
• Gene ID (NCBI): 23220
• RRID: AB_2879970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2E6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DTX4, also named as KIAA0937, RNF155, is a 619 amino acid protein, which belongs to the Deltex family. DTX4 as a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX4 functions as a ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.