Home
Products
Primary Antibodies
DVL1 Polyclonal antibody, PBS Only (27384-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis using 27384-1-AP (same clone as 27384-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
WB analysis using 27384-1-AP (same clone as 27384-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
WB analysis using 27384-1-AP (same clone as 27384-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
WB analysis using 27384-1-AP (same clone as 27384-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 27384-1-AP (same clone as 27384-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
WB analysis of mouse cerebellum using 27384-1-AP (same clone as 27384-1-PBS)
mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 27384-1-AP (DVL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IP experiment of HEK-293 using 27384-1-AP (same clone as 27384-1-PBS)
IP result of anti-DVL1 (IP:27384-1-AP, 4ug; Detection:27384-1-AP 1:3000) with HEK-293 cells lysate 1560 ug. This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 27384-1-AP (same clone as 27384-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27384-1-AP (DVL1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 27384-1-AP (same clone as 27384-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DVL1 antibody (27384-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27384-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

DVL1 Polyclonal antibody, PBS Only

Name: DVL1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27384-1-PBS

DVL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 27384-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Dishevelled 1, Dishevelled-1, DSH homolog 1, DVL, Segment polarity protein dishevelled homolog DVL-1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27384-1-PBS targets DVL1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26055 Product name: Recombinant human DVL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species
Full Name	dishevelled, dsh homolog 1 (Drosophila)
Calculated Molecular Weight	75 kDa
Observed Molecular Weight	73-75 kDa
GenBank Accession Number	BC050454
Gene Symbol	DVL1
Gene ID (NCBI)	1855
RRID	AB_2880859
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14640
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway.