DVL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DVL3 Polyclonal antibody (13444-1-AP)

DVL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13444-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Dishevelled 3, Segment polarity protein dishevelled homolog DVL-3, KIAA0208, DSH homolog 3, Dishevelled-3

• 

  WB analysis using 13444-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 13444-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Raji using 13444-1-AP

  IP result of anti-DVL3 (IP:13444-1-AP, 4ug; Detection:13444-1-AP 1:500) with Raji cells lysate 1440ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 13444-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13444-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DVL3 antibody (13444-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13444-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13444-1-AP (DVL3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DVL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, Raji cells
• Positive IP detected in: Raji cells
• Positive IHC detected in: human colon cancer tissue, human prostate cancer tissue, mouse colon tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13444-1-AP targets DVL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, xenopus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4272

  Product name: Recombinant human DVL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-319 aa of BC032459

  Sequence: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVL

• Full Name: dishevelled, dsh homolog 3 (Drosophila)
• Calculated Molecular Weight: 716 aa, 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC032459
• Gene Symbol: DVL3
• Gene ID (NCBI): 1857
• RRID: AB_2093451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92997
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DVL3 Polyclonal antibody (Cat# 13444-1-AP) has 17 citations across journals including Advanced Science, Cancer Letters, Oncogene, Journal of Cell Biology, International Journal of Biological Sciences, Journal of Translational Medicine, Molecules, Stem Cells, Molecular Carcinogenesis, eLife, Oncotarget, and bioRxiv. Research fields span Wnt/β-catenin signaling, cardiac remodeling, tumor metastasis and EMT, multiple myeloma, endometrial fibrosis, hepatocellular carcinoma, breast cancer, bladder cancer, ciliogenesis, planar cell polarity, and axon guidance.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); PNPO-Mediated Oxidation of DVL3 Promotes Multiple Myeloma Malignancy and Osteoclastogenesis by Activating the Wnt/β-Catenin Pathway; Authors - Zhendong Deng
		Adv Sci (Weinh); ZER1 Restrains Pressure Overload-Induced Cardiac Remodeling by Targeting DVL2 for Gly/N-Degron-Dependent Degradation.; Authors - Mingchao Jiang
human	WB	Cancer Lett; SOX2 promotes tumor metastasis by stimulating epithelial-to-mesenchymal transition via regulation of WNT/β-catenin signal network.; Authors - Li Xuefei X
human	WB,IP	Int J Biol Sci; CYR61 Acts as an Intracellular Microtubule-Associated Protein and Coordinates Mitotic Progression via PLK1-FBW7 Pathway; Authors - Kaishun Hu
	WB	J Transl Med; DKK1 loss promotes endometrial fibrosis via autophagy and exosome-mediated macrophage-to-myofibroblast transition; Authors - Zhanqin Zhang
human	WB	Oncogene; The Wnt/β-catenin/VASP positive feedback loop drives cell proliferation and migration in breast cancer.; Authors - Kai Li