DYDC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DYDC1 Polyclonal antibody (26327-1-AP)

DYDC1 Polyclonal Antibody for WB, ELISA

Cat No. 26327-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

DPY30 domain containing 1, DPY30D1, DYDC1, RSD 9

• 

  WB analysis of mouse testis using 26327-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26327-1-AP (DYDC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DYDC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26327-1-AP targets DYDC1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23693

  Product name: Recombinant human DYDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-177 aa of BC019250

  Sequence: LWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL

• Full Name: DPY30 domain containing 1
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC019250
• Gene Symbol: DYDC1
• Gene ID (NCBI): 143241
• RRID: AB_2880480
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWB3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DYDC1 Polyclonal antibody (Cat# 26327-1-AP) has 1 citation to date. The cited publication appeared in Cell Reports (IF 7.7, 2022), investigating the differential roles of IQUB in radial spoke 1 assembly and ciliary/flagellar motility in mice. The antibody was used by Western blot in mouse samples. The research falls within the fields of cilia biology, cell motility, and structural assembly of flagellar components.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella; Authors - Xin Zhang