DZIP1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DZIP1L Polyclonal antibody, PBS Only (17274-1-PBS)

• 

  WB analysis using 17274-1-AP (same clone as 17274-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17274-1-AP (DZIP1L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17274-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17274-1-AP (same clone as 17274-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17274-1-AP (DZIP1L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17274-1-PBS in a different storage buffer formulation.

DZIP1L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17274-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Cilium assembly protein DZIP1L, DAZ interacting protein 1 like, DAZ-interacting zinc finger protein 1-like, DZIP2, Zinc finger protein DZIP1L

---

Product Information

17274-1-PBS targets DZIP1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11034

  Product name: Recombinant human DZIP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 418-767 aa of BC033308

  Sequence: KAVDTEEDSPEEEMEDSQDEQHKVLAALRRNPTLLKHFRPILEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAAVSQPDGQPSVKSQQSALVTREAQPKTRTLQVALPSTPAEPPPPTRQSHGSHGSSLTQVSAPAPHPGLHGPSSTPPSSGPGMSTPPFSSEEDSEGDRVQRVSLQPPKVPSRMVPRPKDDWDWSDTETSEENAQPPGQGSGTLVQSMVKNLEKQLEAPAKKPAGGVSLFFMPNAGPQRAATPGRKPQLSEDESDLEISSLEDLPLDLDQREKPKPLSRSKLPEKFGTGPQSSGQPRVPAW

• Full Name: DAZ interacting protein 1-like
• Calculated Molecular Weight: 767 aa, 87 kDa
• Observed Molecular Weight: 87 kDa
• GenBank Accession Number: BC033308
• Gene Symbol: DZIP1L
• Gene ID (NCBI): 199221
• RRID: AB_3669266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DZIP1L, or DAZ interacting zinc finger protein 1-like, is a protein implicated in autosomal recessive polycystic kidney disease (ARPKD). DZIP1L has been shown to localize to centrioles and at the distal end of basal bodies, interacting with septin2, a protein that maintains the periciliary diffusion barrier at the ciliary transition zone (PMID: 28530676).