CoraLite® Plus 647-conjugated Desmin Recombinant monoclonal antibody

Desmin Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL647-82748
Clone No.1D21

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF-P

1D21, DES

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-82748 targets Desmin in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9742

Product name: Recombinant human Desmin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 121-470 aa of BC032116

Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Predict reactive species
Full Name desmin
Calculated Molecular Weight 470 aa, 54 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC032116
Gene Symbol Desmin
Gene ID (NCBI) 1674
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17661
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 Desmin antibody CL647-82748Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...