Desmoplakin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Desmoplakin Polyclonal antibody, PBS Only (25318-1-PBS)

• 

  WB analysis of HepG2 using 25318-1-AP (same clone as 25318-1-PBS)

  WB result of Desmoplakin antibody (25318-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Desmoplakin transfected HepG2 cells. This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25318-1-AP (same clone as 25318-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25318-1-AP (Desmoplakin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 25318-1-AP (same clone as 25318-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25318-1-AP (Desmoplakin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IP experiment of BxPC-3 using 25318-1-AP (same clone as 25318-1-PBS)

  IP result of anti-Desmoplakin (IP:25318-1-AP, 4ug; Detection:25318-1-AP 1:10000) with BxPC-3 cells lysate 2080 ug. This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 25318-1-PBS

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 25318-1-PBS

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 25318-1-PBS

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 25318-1-PBS

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 25318-1-AP (same clone as 25318-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human bowen disease using 25318-1-AP (same clone as 25318-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25318-1-AP (same clone as 25318-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25318-1-AP (same clone as 25318-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25318-1-AP (same clone as 25318-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25318-1-AP (Desmoplakin antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 25318-1-AP (same clone as 25318-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Desmoplakin antibody (25318-1-AP) at dilution of 1:1500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Beta Actin antibody (66009-1-Ig, Clone: 2D4H5, red). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 25318-1-AP (same clone as 25318-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Desmoplakin antibody (25318-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 25318-1-AP (same clone as 25318-1-PBS)

  1X10^6 A431 cells were intracellularly stained with 0.4 ug Anti-Human Desmoplakin (25318-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 25318-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Desmoplakin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 25318-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

---

Product Information

25318-1-PBS targets Desmoplakin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18065

  Product name: Recombinant human DSP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC140802

  Sequence: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY

• Full Name: desmoplakin
• Calculated Molecular Weight: 2871 aa, 332 kDa
• Observed Molecular Weight: 240-330 kDa
• GenBank Accession Number: BC140802
• Gene Symbol: DSP
• Gene ID (NCBI): 1832
• RRID: AB_2880028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15924
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The desmoplakin (DP) is the most abundant desmosomal proteins and is located at the cytoplasmic portion of the desmosomes which are specialized cell-cell adhesion structures abundant in tissues such as muscle and epidermis that are subjected to mechanical stress. Desmoplakin 1 and 2 (DP 1 and 2) are two splice variants sharing common C-terminal and N-terminal globular head and tail domains, but differ in the length of the rod domain that links them. This antibody detects both DP1 (280-330 kDa) and DP2 (240-260 kDa). (PMID: 16467215, 11781569)