CoraLite® Plus 488-conjugated E-selectin / CD62E Polyclonal antibody

• 

  IF Staining of HUVEC using CL488-30205

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using CoraLite® Plus 488 E-selectin / CD62E antibody (CL488-30205) at dilution of 1:200.

E-selectin / CD62E Polyclonal Antibody for IF/ICC

Cat No. CL488-30205

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CD62E, E-selectin, CD62 antigen-like family member E, E selectin, ELAM

---

Tested Applications

• Positive IF/ICC detected in: HUVEC cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-30205 targets E-selectin / CD62E in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31820

  Product name: Recombinant human SELE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-371 aa of BC142711

  Sequence: KCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS

• Full Name: selectin E
• Calculated Molecular Weight: 610 aa, 67 kDa
• GenBank Accession Number: BC142711
• Gene Symbol: CD62E
• Gene ID (NCBI): 6401
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16581
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

E-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958)