EAAT4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EAAT4 Polyclonal antibody, PBS Only (12876-1-PBS)

• 

  WB analysis of A375 using 12876-1-AP (same clone as 12876-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12876-1-AP (EAAT4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12876-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 12876-1-AP (same clone as 12876-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse cerebellum tissue using EAAT4 antibody (12876-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12876-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 12876-1-AP (same clone as 12876-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse cerebellum tissue using EAAT4 antibody (12876-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12876-1-PBS in a different storage buffer formulation.

EAAT4 Polyclonal Antibody for WB, IF-Fro, Indirect ELISA

Cat No. 12876-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-Fro, Indirect ELISA

Synonyms

SLC1A6, Sodium-dependent glutamate/aspartate transporter

---

Product Information

12876-1-PBS targets EAAT4 in WB, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3554

  Product name: Recombinant human SLC1A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 149-271 aa of BC028721

  Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

• Full Name: solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
• Calculated Molecular Weight: 61.6 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC028721
• Gene Symbol: EAAT4
• Gene ID (NCBI): 6511
• RRID: AB_10642147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48664
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Excitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and/or phosphorylation (24056007). This antibody recognizes 60-70 kDa of EAAT4 in mouse brain and several other lysate.