Product Information
12876-1-PBS targets EAAT4 in WB, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3554 Product name: Recombinant human SLC1A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 149-271 aa of BC028721 Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL Predict reactive species |
| Full Name | solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 |
| Calculated Molecular Weight | 61.6 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC028721 |
| Gene Symbol | EAAT4 |
| Gene ID (NCBI) | 6511 |
| RRID | AB_10642147 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48664 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Excitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and/or phosphorylation (24056007). This antibody recognizes 60-70 kDa of EAAT4 in mouse brain and several other lysate.





