EAF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EAF1 Polyclonal antibody (13787-1-AP)

EAF1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13787-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA, CUT&Tag

Synonyms

ELL-associated factor 1

• 

  WB analysis of K-562 using 13787-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13787-1-AP (EAF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13787-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13787-1-AP (EAF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13787-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13787-1-AP (EAF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 13787-1-AP

  IP result of anti-EAF1 (IP:13787-1-AP, 4ug; Detection:13787-1-AP 1:500) with HeLa cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 13787-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13787-1-AP (EAF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 13787-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13787-1-AP (EAF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 13787-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 13787-1-AP (EAF1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EAF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, mouse brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13787-1-AP targets EAF1 in WB, IHC, IF/ICC, IP, ELISA, CUT&Tag applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4804

  Product name: Recombinant human EAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-268 aa of BC041329

  Sequence: MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD

• Full Name: ELL associated factor 1
• Calculated Molecular Weight: 268 aa, 29 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC041329
• Gene Symbol: EAF1
• Gene ID (NCBI): 85403
• RRID: AB_2255402
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELL associated factor 1 and ELL associated factor 2 (EAF1/2 factors) are reported to play important roles in tumor suppression and embryogenesis. The tumor suppressor EAF2 is regulated by androgen signaling and associated with prostate cancer. Eaf factors have been revealed to modulate mesoderm and neural patterning by inhibiting canonical Wnt signaling, and high activity of canonical Wnt/β-catenin is revealed in eafs morphants (PMID: 23364330). Catalog#13787-1-AP is a rabbit polyclonal antibody raised against the full-length of human EAF1.

Publications

What published studies show

The EAF1 Polyclonal antibody (Cat# 13787-1-AP) has 7 total citations. These appear in journals including Cell, Molecular Cell, Cell Death & Differentiation, Biochimica et Biophysica Acta, Biochimica et Biophysica Acta – Gene Regulatory Mechanisms, and Microvascular Research. The associated research fields span transcription elongation, HIV-1 transcription regulation, tumorigenesis, embryogenesis, TGF-β signaling, atherosclerosis, and RNA processing.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Cell; Inherited blood cancer predisposition through altered transcription elongation; Authors - Jiawei Zhao
human	WB	Mol Cell; HIV-1 Tat assembles a multifunctional transcription elongation complex and stably associates with the 7SK snRNP.; Authors - Bijan Sobhian
human	WB	Cell Death Differ; Global identification of phospho-dependent SCF substrates reveals a FBXO22 phosphodegron and an ERK-FBXO22-BAG3 axis in tumorigenesis.; Authors - Ping Liu
	WB	Biochim Biophys Acta; Transcriptional factors Eaf1/2 inhibit endoderm and mesoderm formation via suppressing TGF-β signaling.; Authors - Jing-Xia Liu
human	WB	Biochim Biophys Acta Gene Regul Mech; ELL-associated factors EAF1/2 negatively regulate HIV-1 transcription through inhibition of Super Elongation Complex formation.; Authors - Rongdiao Liu
human	WB	Microvasc Res; PEAR1/EAF1 deficiency impairs aspirin responsiveness in atherosclerotic endothelium: A novel mechanism of atypical aspirin resistance.; Authors - Jingjing Liu