EAF6 Polyclonal antibody

• 

  WB analysis of HepG2 using 26465-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26465-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26465-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 26465-1-AP

  IP result of anti-EAF6 (IP:26465-1-AP, 4ug; Detection:26465-1-AP 1:500) with HepG2 cells lysate 3480ug.

EAF6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26465-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IP, ELISA

Synonyms

C1orf149, CDABP0189, CENP-28, Chromatin modification-related protein MEAF6, Esa1-associated factor 6 homolog

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

26465-1-AP targets EAF6 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23971

  Product name: Recombinant human C1orf149 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC016328

  Sequence: MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY

• Full Name: chromosome 1 open reading frame 149
• Observed Molecular Weight: 22-28 kDa
• GenBank Accession Number: BC016328
• Gene Symbol: MEAF6
• Gene ID (NCBI): 64769
• RRID: AB_2880524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; MOZ and Menin-MLL Complexes are Complementary Regulators of Chromatin Association and Transcriptional Output in Gastrointestinal Stromal Tumor.; Authors - Matthew L Hemming
mouse	WB	Cell Death Differ; MACF1 promotes osteoblast differentiation by sequestering repressors in cytoplasm.; Authors - Lifang Hu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jessica (Verified Customer) (10-06-2025)

Effective in western blot at 1:1000 dilution and in co-IP. Strong bands and efficient pull-down

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:1000