EAF6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EAF6 Polyclonal antibody (26465-1-AP)

EAF6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26465-1-AP Copied!

Publications (2)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IP, ELISA

Synonyms

C1orf149, CDABP0189, CENP-28, Chromatin modification-related protein MEAF6, Esa1-associated factor 6 homolog

• 

  WB analysis of HepG2 using 26465-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 26465-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 26465-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26465-1-AP (EAF6 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 26465-1-AP

  IP result of anti-EAF6 (IP:26465-1-AP, 4ug; Detection:26465-1-AP 1:500) with HepG2 cells lysate 3480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EAF6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26465-1-AP targets EAF6 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23971

  Product name: Recombinant human C1orf149 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC016328

  Sequence: MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY

• Full Name: chromosome 1 open reading frame 149
• Observed Molecular Weight: 22-28 kDa
• GenBank Accession Number: BC016328
• Gene Symbol: MEAF6
• Gene ID (NCBI): 64769
• RRID: AB_2880524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EAF6 Polyclonal antibody (Cat# 26465-1-AP) has 2 citations. One appears in Cancer Discovery (2022), studying MOZ and Menin-MLL complexes in gastrointestinal stromal tumors. The other is in Cell Death & Differentiation (2021), examining MACF1's role in osteoblast differentiation. Both studies used the antibody for Western blot, covering human and mouse species. The research fields span oncology (GIST) and bone biology (osteoblast differentiation).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; MOZ and Menin-MLL Complexes are Complementary Regulators of Chromatin Association and Transcriptional Output in Gastrointestinal Stromal Tumor.; Authors - Matthew L Hemming
mouse	WB	Cell Death Differ; MACF1 promotes osteoblast differentiation by sequestering repressors in cytoplasm.; Authors - Lifang Hu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product received a 5-star rating. The reviewer reported it performed effectively in both Western Blot at a 1:1000 dilution and in co-immunoprecipitation, producing strong bands and efficient pull-down. Overall, the feedback highlights reliable performance across these applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Jessica (Verified Customer) (10-06-2025)

Effective in western blot at 1:1000 dilution and in co-IP. Strong bands and efficient pull-down

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:1000