ECE1 Polyclonal antibody

ECE1 Polyclonal Antibody for WB, ELISA
Cat No. 27245-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

ECE, ECE 1, ECE1, endothelin converting enzyme 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HUVEC cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27245-1-AP targets ECE1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26124

Product name: Recombinant human ECE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 90-189 aa of BC126257

Sequence: QYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNET

Predict reactive species
Full Name endothelin converting enzyme 1
Observed Molecular Weight87-110 kDa
GenBank Accession NumberBC126257
Gene Symbol ECE1
Gene ID (NCBI) 1889
RRIDAB_3085941
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42892
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ECE1, Endothelin-converting enzyme 1, also known as ECE. It is located in cell membrane, and it has 4 isoforms. All isoforms are expressed in umbilical vein endothelial cells, polynuclear neutrophils, fibroblasts, atrium cardiomyocytes and ventricles. Isoforms A, B and C are also expressed in placenta, lung, heart, adrenal gland and phaeochromocytoma; isoforms A and C in liver, testis and small intestine; isoform B, C and D in endothelial cells and umbilical vein smooth muscle cells; isoforms C and D in saphenous vein cells, and isoform C in kidney (PMID: 9396733). The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. The calculated molecular weight of ECE1 is 87 kDa, as a result of glycosylation, the apparent molecular mass of ECE1 is approximately 87-110 kDa.

Protocols

Product Specific Protocols
WB protocol for ECE1 antibody 27245-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...