ECHDC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ECHDC2 Polyclonal antibody, PBS Only (26126-1-PBS)

• 

  WB analysis using 26126-1-AP (same clone as 26126-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 26126-1-AP (ECHDC2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26126-1-PBS in a different storage buffer formulation.

ECHDC2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26126-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Enoyl-CoA hydratase domain-containing protein 2, mitochondrial

---

Product Information

26126-1-PBS targets ECHDC2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23510

  Product name: Recombinant human ECHDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-90 aa of BC044574

  Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF

• Full Name: enoyl Coenzyme A hydratase domain containing 2
• Observed Molecular Weight: 29-31 kDa
• GenBank Accession Number: BC044574
• Gene Symbol: ECHDC2
• Gene ID (NCBI): 55268
• RRID: AB_3085842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ECHDC2 (Enoyl-CoA Hydratase Domain Containing 2) is a protein-coding gene that encodes a mitochondrial enzyme. ECHDC2 is involved in fatty acid β-oxidation and branched-chain amino acid catabolism.