ECM2 Polyclonal antibody

• 

  IHC staining of mouse cerebellum using 21376-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21376-1-AP (ECM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 21376-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21376-1-AP (ECM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary using 21376-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 21376-1-AP (ECM2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 21376-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 21376-1-AP (ECM2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of L02 using 21376-1-AP

  Immunofluorescent analysis of L02 cells using 21376-1-AP (ECM2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ECM2 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 21376-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Matrix glycoprotein SC1/ECM2

---

Tested Applications

• Positive IHC detected in: mouse cerebellum tissue, human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: L02 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

21376-1-AP targets ECM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15913

  Product name: Recombinant human ECM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-699 aa of BC107493

  Sequence: LTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK

• Full Name: extracellular matrix protein 2, female organ and adipocyte specific
• Calculated Molecular Weight: 699 aa, 80 kDa
• GenBank Accession Number: BC107493
• Gene Symbol: ECM2
• Gene ID (NCBI): 1842
• RRID: AB_2878850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94769
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Microbiol Spectr; Transcriptome analysis reveals that PRV XJ delgE/gI/TK protects against intestinal damage in nose-dropping-infected mice by regulating ECM-ITGA/ITGB-P-FAK; Authors - Tong Xu
human	WB	Mol Neuropsychiatry; Cell Type-Specific Effects of Mutant DISC1: A Proteomics Study.; Authors - Meng Xia
human	IHC	Int J Biochem Cell Biol; ECM2, a prognostic biomarker for lower grade glioma, serves as a potential novel target for immunotherapy; Authors - Xingbo Cheng