ECM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ECM2 Polyclonal antibody, PBS Only (21376-1-PBS)

• 

  IHC staining of mouse cerebellum using 21376-1-AP (same clone as 21376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21376-1-AP (ECM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21376-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 21376-1-AP (same clone as 21376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21376-1-AP (ECM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21376-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 21376-1-AP (same clone as 21376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 21376-1-AP (ECM2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21376-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 21376-1-AP (same clone as 21376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 21376-1-AP (ECM2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21376-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 21376-1-AP (same clone as 21376-1-PBS)

  Immunofluorescent analysis of L02 cells using 21376-1-AP (ECM2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21376-1-PBS in a different storage buffer formulation.

ECM2 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 21376-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21376-1-PBS targets ECM2 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15913

  Product name: Recombinant human ECM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-699 aa of BC107493

  Sequence: LTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK

• Full Name: extracellular matrix protein 2, female organ and adipocyte specific
• Calculated Molecular Weight: 699 aa, 80 kDa
• GenBank Accession Number: BC107493
• Gene Symbol: ECM2
• Gene ID (NCBI): 1842
• RRID: AB_2878850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.