EDDM3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EDDM3B Polyclonal antibody, PBS Only (32425-1-PBS)

• 

  WB analysis using 32425-1-AP (same clone as 32425-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32425-1-AP (EDDM3B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32425-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human testis using 32425-1-AP (same clone as 32425-1-PBS)

  IP result of anti-EDDM3B (IP:32425-1-AP, 4ug; Detection:32425-1-AP 1:500) with human testis tissue lysate 4080 ug. This data was developed using the same antibody clone with 32425-1-PBS in a different storage buffer formulation.

EDDM3B Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32425-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Epididymal secretory protein E3-beta, FAM12B, HE3B, HE3-beta, Human epididymis-specific protein 3-beta

---

Product Information

32425-1-PBS targets EDDM3B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37630

  Product name: Recombinant human EDDM3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-118 aa of NM_022360

  Sequence: RENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESR

• Full Name: family with sequence similarity 12, member B (epididymal)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: NM_022360
• Gene Symbol: FAM12B
• Gene ID (NCBI): 64184
• RRID: AB_3742606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P56851
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EDDM3B (Epididymal secretory protein E3-beta), also known as FAM12B, HE3B (Human epididymis-specific protein 3-beta), is highly enriched in the epididymis and is involved in the secretion of glycoproteins that interact with sperm membranes.