Filter: AllWBIPIHC

WB analysis of 3T3-L1 using 27310-1-AP (same clone as 27310-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27310-1-AP (EDEM3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27310-1-PBS in a different storage buffer formulation.
IP experiment of HEK-293 using 27310-1-AP (same clone as 27310-1-PBS)
IP result of anti-EDEM3 (IP:27310-1-AP, 4ug; Detection:27310-1-AP 1:300) with HEK-293 cells lysate 2600ug. This data was developed using the same antibody clone with 27310-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 27310-1-AP (same clone as 27310-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27310-1-AP (EDEM3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27310-1-PBS in a different storage buffer formulation.

EDEM3 Polyclonal antibody, PBS Only

Name: EDEM3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27310-1-PBS

EDEM3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27310-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ER degradation-enhancing alpha-mannosidase-like protein 3, EC:3.2.1.113, C1orf22, Alpha-1,2-mannosidase EDEM3

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

27310-1-PBS targets EDEM3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26123 Product name: Recombinant human EDEM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016464 Sequence: DNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDEL Predict reactive species
Full Name	ER degradation enhancer, mannosidase alpha-like 3
Calculated Molecular Weight	105 kDa
Observed Molecular Weight	100-110 kDa
GenBank Accession Number	BC016464
Gene Symbol	EDEM3
Gene ID (NCBI)	80267
RRID	AB_2880839
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BZQ6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™