EDF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EDF1 Polyclonal antibody, PBS Only (12419-1-PBS)

• 

  WB analysis of A549 using 12419-1-AP (same clone as 12419-1-PBS)

  WB result of EDF1 antibody (12419-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-EDF1 transfected A549 cells. This data was developed using the same antibody clone with 12419-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12419-1-AP (same clone as 12419-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12419-1-AP (EDF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12419-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 12419-1-AP (same clone as 12419-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12419-1-AP (EDF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12419-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 12419-1-AP (same clone as 12419-1-PBS)

  IP result of anti-EDF1 (IP:12419-1-AP, 4ug; Detection:12419-1-AP 1:500) with Jurkat cells lysate 2920 ug. This data was developed using the same antibody clone with 12419-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12419-1-AP (same clone as 12419-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12419-1-AP (EDF1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12419-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EDF1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12419-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12419-1-PBS targets EDF1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3063

  Product name: Recombinant human EDF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC015500

  Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

• Full Name: endothelial differentiation-related factor 1
• Calculated Molecular Weight: 148 aa, 16 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC015500
• Gene Symbol: EDF1
• Gene ID (NCBI): 8721
• RRID: AB_2230895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60869
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.