EDG2/LPA1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EDG2/LPA1 Polyclonal antibody, PBS Only (20442-1-PBS)

• 

  WB analysis of Jurkat using 20442-1-AP (same clone as 20442-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of multi-cells/tissue using 20442-1-AP (same clone as 20442-1-PBS)

  Multi-cells/tissue were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20442-1-AP (same clone as 20442-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2/LPA1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20442-1-AP (same clone as 20442-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20442-1-AP (same clone as 20442-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 20442-1-AP (same clone as 20442-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 20442-1-AP (EDG2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20442-1-AP (same clone as 20442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20442-1-AP (EDG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20442-1-AP (same clone as 20442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20442-1-AP (EDG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20442-1-AP (same clone as 20442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 20442-1-AP (LPAR1,EDG2 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20442-1-AP (same clone as 20442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 20442-1-AP (LPAR1,EDG2 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 20442-1-AP (same clone as 20442-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug EDG2 Polyclonal antibody (20442-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 20442-1-PBS in a different storage buffer formulation.

EDG2/LPA1 Polyclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 20442-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

LPAR1, edg 2, EDG2, Gpcr26, GPR26

---

Product Information

20442-1-PBS targets EDG2/LPA1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14253

  Product name: Recombinant human LPAR1,EDG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-364 aa of BC030615

  Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV

• Full Name: lysophosphatidic acid receptor 1
• Calculated Molecular Weight: 364 aa, 41 kDa
• Observed Molecular Weight: 41-50 kDa
• GenBank Accession Number: BC030615
• Gene Symbol: EDG2
• Gene ID (NCBI): 1902
• RRID: AB_11183048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92633
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233).