Product Information
20442-1-PBS targets EDG2/LPA1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14253 Product name: Recombinant human LPAR1,EDG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-364 aa of BC030615 Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV Predict reactive species |
| Full Name | lysophosphatidic acid receptor 1 |
| Calculated Molecular Weight | 364 aa, 41 kDa |
| Observed Molecular Weight | 41-50 kDa |
| GenBank Accession Number | BC030615 |
| Gene Symbol | EDG2 |
| Gene ID (NCBI) | 1902 |
| RRID | AB_11183048 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92633 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
EDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233).





















