Endothelin 1 Monoclonal antibody

• 

  WB analysis of human placenta using 67008-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67008-1-Ig (EDN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

Endothelin 1 Monoclonal Antibody for WB, ELISA

Cat No. 67008-1-Ig

Clone No.2C5B3

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (2)

Applications

WB, ELISA

Synonyms

EDN1, endothelin 1, ET 1 Big endothelin 1, ET1, HDLCQ7, PPET1, Preproendothelin 1

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

67008-1-Ig targets Endothelin 1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28334

  Product name: Recombinant human EDN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC009720

  Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

• Full Name: endothelin 1
• Calculated Molecular Weight: 212 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC009720
• Gene Symbol: Endothelin 1
• Gene ID (NCBI): 1906
• RRID: AB_2882325
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05305
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDN1, also named as Endothelin-1, PPET1 and ET-1, belongs to the endothelin/sarafotoxin family. Endothelins are endothelium-derived vasoconstrictor peptides. Emerging basic science, and animal and human data all suggest that EDN1 is a potentially important contributor in the pathobiology of fibrosing disorders, including those that affect the lung(PMID:20055532 ).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Trace Elem Med Biol; The association between endothelial function and autoimmune thyroiditis induced by iodine excess; Authors - Dandan Wang
human	WB	Biomed Rep; Cilostazol regulates the expressions of endothelin-1 and endothelial nitric oxide synthase via activation of the p38 MAPK signaling pathway in HUVECs; Authors - Ying Xue
human	WB	Hypertens Res; Endothelial-derived complement factor D contributes to endothelial dysfunction in malignant nephrosclerosis via local complement activation; Authors - Zheng Wang