Endothelin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Endothelin 1 Polyclonal antibody (12191-1-AP)

• Featured Product
• KD/KO Validated

Endothelin 1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 12191-1-AP Copied!

Publications (40)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Synonyms

EDN1, Big endothelin-1, Endothelin-1, ET 1 Big endothelin 1, ET1

• 

  WB analysis of NIH/3T3 using 12191-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12191-1-AP (Endothelin 1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 12191-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 12191-1-AP (Endothelin 1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 12191-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 12191-1-AP (Endothelin 1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HUVEC using 12191-1-AP

  1X10^6 HUVEC cells were intracellularly stained with 0.4 ug Anti-Human Endothelin 1 (12191-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Endothelin 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells
• Positive IHC detected in: mouse lung tissue, mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12191-1-AP targets Endothelin 1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2847

  Product name: Recombinant human EDN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC009720

  Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

• Full Name: endothelin 1
• Calculated Molecular Weight: 212 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC009720
• Gene Symbol: Endothelin 1
• Gene ID (NCBI): 1906
• RRID: AB_889392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05305
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDN1, also named as Endothelin-1, PPET1 and ET-1, belongs to the endothelin/sarafotoxin family. Endothelins are endothelium-derived vasoconstrictor peptides. Emerging basic science, and animal and human data all suggest that EDN1 is a potentially important contributor in the pathobiology of fibrosing disorders, including those that affect the lung(PMID:20055532 ).

Publications

What published studies show

Anti-Endothelin-1 (EDN1) Antibody, Catalog No. 12191-1-AP, has 40 total citations. Journals include Cancer Research, Redox Biology, Theranostics, Advanced Science, International Journal of Biological Sciences, Phytomedicine, Acta Pharmacologica Sinica, Molecular Medicine, Life Sciences, iScience, Cell Signaling, Placenta, Brain Research, and others. Research fields span cardiovascular disease (endothelial dysfunction, atherosclerosis, myocardial ischemia-reperfusion), oncology (breast cancer, hepatocellular carcinoma), diabetes complications, neurology, preeclampsia, fibrosis, and immunology.

Automatically generated from the 40 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cancer Res; Lactoferrin-endothelin-1 axis contributes to the development and invasiveness of triple-negative breast cancer phenotypes.; Authors - Ngoc-Han Ha
mouse	WB	Redox Biol; Exercise protects aged mice against coronary endothelial senescence via FUNDC1-dependent mitophagy; Authors - Lijie Ma
mouse	IF	Redox Biol; Blocking mitochondrial cyclophilin D ameliorates TSH-impaired defensive barrier of artery.; Authors - Xiaojing Liu
		Theranostics; Neutrophil extracellular traps induce endothelial damage and exacerbate vasospasm in traumatic brain injury; Authors - Jinchao Wang
mouse, human	WB	Adv Sci (Weinh); Canagliflozin Alleviates Diabetic Glomerular Endothelial Injury via Melibiose in a Microbiota-Dependent Manner.; Authors - Wei Zhang
human	WB	Int J Biol Sci; Roquin2 suppresses breast cancer progression by inhibiting tumor angiogenesis via selectively destabilizing proangiogenic factors mRNA.; Authors - Meicen Zhou