EDN2 Polyclonal antibody

• 

  IHC staining of human lung cancer using 13272-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13272-1-AP (EDN2 antibody) at dilution of 1:100 (under 40x lens).

EDN2 Polyclonal Antibody for IHC, ELISA

Cat No. 13272-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

EDN2, endothelin 2, ET 2, ET2, PPET2, Preproendothelin 2

---

Product Information

13272-1-AP targets EDN2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3969

  Product name: Recombinant human EDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-178 aa of BC034393

  Sequence: EGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR

• Full Name: endothelin 2
• Calculated Molecular Weight: 178 aa, 20 kDa
• GenBank Accession Number: BC034393
• Gene Symbol: EDN2
• Gene ID (NCBI): 1907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20800
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.