EEA1 Recombinant monoclonal antibody

• 

  WB analysis using 81245-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81245-1-RR (EEA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 81245-1-RR

  WB result of EEA1 antibody (81245-1-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEA1 transfected HepG2 cells.

• 

  Affinity and Kinetic Characterization of 81245-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81245-1-RR against Human EEA1 were performed. The affinity constant is 0.227 nM.

• Featured Product
• KD/KO Validated

EEA1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 81245-1-RR

Clone No.2C11

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

Synonyms

ZFYVE2, MSTP105, MST105, Endosome-associated protein p162, Early endosome antigen 1

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, HeLa cells, LNCaP cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81245-1-RR targets EEA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2923711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.