Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EEF1B2 Polyclonal antibody

EEF1B2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Elongation factor 1 beta, EF-1-beta, EF1B, EF 1 beta, EEF1B1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EEF1B2 in ?

Tested Applications

Positive WB detected inPC-3 cells, RAW264.7, Jurkat cells, HEK-293 cells, HeLa cells, SKOV-3 cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman colon tissue, human breast cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10095-2-AP targets EEF1B2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0135

Product name: Recombinant human EEF1B2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-223 aa of BC000211

Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFN

Predict reactive species
Full Name eukaryotic translation elongation factor 1 beta 2
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC000211
Gene Symbol EEF1B2
Gene ID (NCBI) 1933
RRIDAB_2096987
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24534
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In eukaryotes, the translation elongation factor eEF1A responsible for transporting amino-acylated tRNA to the ribosome forms a higher-order complex, eEF1H, with its guanine-nucleotide-exchange factor eEF1B. eEF1B consists of three subunits: eEF1B alpha, eEF1B beta and eEF1B gamma. The eEF1B2 possess the nucleotide-exchange activity. Although several models on the basis of in vitro experiments have been proposed for the macromolecular organization of the eEF1H complex, these models differ in various aspects. The human eukaryote elongation factor 1 beta 2 (eEF1B2) migrated as a 30-34 kDa protein in SDS-PAGE. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human EEF1B2.

Protocols

Product Specific Protocols
IF protocol for EEF1B2 antibody 10095-2-APDownload protocol
IHC protocol for EEF1B2 antibody 10095-2-APDownload protocol
IP protocol for EEF1B2 antibody 10095-2-APDownload protocol
WB protocol for EEF1B2 antibody 10095-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EEF1B2 Polyclonal antibody (Cat# 10095-2-AP) has 5 citations published in Nature Cell Biology, Frontiers in Microbiology, PLoS One, Molecular and Cellular Biology, and Biotechniques. Research fields span hepatocellular carcinoma and alternative splicing, influenza A virus protein translation, eEF1B subunit expression and localization, translational repression by RNA-binding proteins, and nascent translation analysis. Applications cited include WB, IHC, IF, IP, and RIP.

SpeciesApplicationTitle
RIP

Nat Cell Biol

The MBNL3 splicing factor promotes hepatocellular carcinoma by increasing PXN expression through the alternative splicing of lncRNA-PXN-AS1.

Authors - Ji-Hang Yuan
humanWB

Front Microbiol

Strain-Specific Contribution of Eukaryotic Elongation Factor 1 Gamma to the Translation of Influenza A Virus Proteins.

Authors - Shuhei Sammaibashi
mouse, humanWB, IHC, IF

PLoS One

Characterisation of Translation Elongation Factor eEF1B Subunit Expression in Mammalian Cells and Tissues and Co-Localisation with eEF1A2.

Authors - Yuan Cao
  • KD Validated
humanWB,IF,IP

Mol Cell Biol

Translational repression by RNA-binding protein TIAR.

Authors - Mazan-Mamczarz Krystyna K
humanWB

Biotechniques

En masse analysis of nascent translation using microarrays.

Authors - Mazan-Mamczarz Krystyna K
Loading...
||
New chat

Able™

正在加载,请稍候...