EFCAB1 Recombinant monoclonal antibody

• 

  WB analysis using 86828-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86828-1-RR (EFCAB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86828-1-RR

  L02 cells were subjected to SDS PAGE followed by western blot with 86828-1-RR (EFCAB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86828-1-RR

  Mouse liver tissue were subjected to SDS PAGE followed by western blot with 86828-1-RR (EFCAB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86828-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86828-1-RR against Human EFCAB1 were performed. The affinity constant is 1.35 nM.

EFCAB1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86828-1-RR

Clone No.251861D3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Calaxin, CLXN, EF-hand calcium-binding domain-containing protein 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, L02 cells, mouse liver tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86828-1-RR targets EFCAB1 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11039

  Product name: Recombinant human EFCAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC025676

  Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM

• Full Name: EF-hand calcium binding domain 1
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 24 kDa, 18 kDa
• GenBank Accession Number: BC025676
• Gene Symbol: EFCAB1
• Gene ID (NCBI): 79645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HAE3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EFCAB1, also known as Calaxin, is a gene that encodes a protein involved in the function of cilia and flagella, which are hair-like structures protruding from the surface of certain cells. Research indicates that EFCAB1 overexpression inhibits cell proliferation, migration, and invasion while promoting apoptosis in lung adenocarcinoma cells. This suggests that EFCAB1 could potentially serve as a biomarker for lung adenocarcinoma.