EFS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EFS Polyclonal antibody (20538-1-AP)

EFS Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20538-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CAS3, CASS3, EFS, EFS1, EFS2, HEFS, SIN

• 

  WB analysis using 20538-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 20538-1-AP (EFS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 20538-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 20538-1-AP (EFS antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse thymus using 20538-1-AP

  IP result of anti-EFS (IP:20538-1-AP, 4ug; Detection:20538-1-AP 1:300) with mouse thymus tissue lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse thymus using 20538-1-AP

  IP result of anti-EFS (IP:20538-1-AP, 4ug; Detection:20538-1-AP 1:300) with mouse thymus tissue lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 20538-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 20538-1-AP (EFS antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 20538-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 20538-1-AP (EFS antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 20538-1-AP

  Immunofluorescent analysis of HepG2 cells, using EFS antibody 20538-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EFS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, human placenta tissue
• Positive IP detected in: mouse thymus tissue
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20538-1-AP targets EFS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14565

  Product name: Recombinant human EFS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-400 aa of BC034246

  Sequence: TPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQLLARSPPPPHRPRLPSAESLSRRPLPALPVPEAPSPSPVPSPAPGRKGSIQDRPLPPPPPRLPGYGGPKVEGDPEGREMEDDPAGHHNEYEGIPMAEEYDYVHLKGMDKAQGSRPPDQACTGDPELPERGMPAPQEALSPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPRLFVPHSKRVVVAAHRLVFVGDTLGR

• Full Name: embryonal Fyn-associated substrate
• Calculated Molecular Weight: 561 aa, 59 kDa
• Observed Molecular Weight: 80-90 kDa, 67-70 kDa
• GenBank Accession Number: BC034246
• Gene Symbol: EFS
• Gene ID (NCBI): 10278
• RRID: AB_10695758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43281
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EFS polyclonal antibody (Cat# 20538-1-AP) has 2 total citations. These appear in Ecotoxicology and Environmental Safety and Frontiers in Genetics. The cited research spans two fields: one study investigates the role of connective tissue growth factor in chondrocyte apoptosis associated with Kashin-Beck disease, while the other explores LYPD3 as a biomarker and therapeutic target for acute myelogenous leukemia. Both citations used the antibody for Western blotting in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Ecotoxicol Environ Saf; Potential involvement of connective tissue growth factor in chondrocytes apoptosis of Kashin-Beck disease; Authors - Xuena Yang
human	WB	Front Genet; LYPD3, a New Biomarker and Therapeutic Target for Acute Myelogenous Leukemia.; Authors - Tingting Hu