EFTUD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67855-1-Ig (same clone as 67855-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67855-1-Ig (EFTUD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67855-1-Ig (same clone as 67855-1-PBS)

  WB result of EFTUD2 antibody (67855-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EFTUD2 transfected HeLa cells. This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67855-1-Ig (same clone as 67855-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67855-1-Ig (EFTUD2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67855-1-Ig (same clone as 67855-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67855-1-Ig (EFTUD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67855-1-Ig (same clone as 67855-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67855-1-Ig (EFTUD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67855-1-Ig (same clone as 67855-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EFTUD2 antibody (67855-1-Ig, Clone: 2F4G2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67855-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EFTUD2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67855-1-PBS

Clone No.2F4G2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DKFZp686E24196, EFTUD2, FLJ44695, hSNU114, KIAA0031, Snrp116, Snu114, SNU114 homolog, U5 116 kDa, U5 116KD

---

Product Information

67855-1-PBS targets EFTUD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24345

  Product name: Recombinant human EFTUD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 13-217 aa of BC002360

  Sequence: IGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTA

• Full Name: elongation factor Tu GTP binding domain containing 2
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 109-120 kDa
• GenBank Accession Number: BC002360
• Gene Symbol: EFTUD2
• Gene ID (NCBI): 9343
• RRID: AB_2918613
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15029
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.