Mouse EGF Recombinant monoclonal antibody, PBS Only (Capture)

EGF Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 84601-1-PBS
Clone No.242000B1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

242000B1, Epidermal growth factor, Pro-epidermal growth factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84601-1-PBS targets EGF as part of a matched antibody pair:

MP01451-1: 84601-1-PBS capture and 84601-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1965

Product name: Recombinant Mouse EGF protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 977-1029 aa of NM_010113

Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Predict reactive species
Full Name epidermal growth factor
Calculated Molecular Weight133 kDa
Observed Molecular Weight150 kDa
GenBank Accession NumberNM_010113
Gene Symbol Egf
Gene ID (NCBI) 13645
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01132
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Epidermal Growth Factor (EGF) is a type of mitogenic factor that stimulates the proliferation of various cells, including epithelial cells and fibroblasts. It is a small peptide composed of 53 amino acids with a molecular weight of approximately 6,000 Daltons. EGF contains three disulfide bonds, which contribute to its stability under acidic and high-temperature conditions. Human EGF is synthesized as transmembrane precursor proteins (1207 amino acids), which are proteolytically cleaved to generate the 54 amino acid mature EGF. EGF plays a crucial role in regulating cell growth, proliferation, and differentiation. When EGF binds to its receptor (EGFR), it activates intracellular signaling pathways that lead to DNA synthesis and cell proliferation. EGF is naturally present in various tissues and body fluids, including saliva, urine, and milk. It is primarily synthesized in the submandibular glands and duodenum.

Loading...
||
New chat

Able

正在加载,请稍候...