EGF Recombinant monoclonal antibody

EGF Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 84601-1-RR
Clone No.242000B1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, ELISA

242000B1, Epidermal growth factor, Pro-epidermal growth factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84601-1-RR targets EGF in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1965

Product name: Recombinant Mouse EGF protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 977-1029 aa of NM_010113

Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Predict reactive species
Full Name epidermal growth factor
Calculated Molecular Weight133 kDa
Observed Molecular Weight150 kDa
GenBank Accession NumberNM_010113
Gene Symbol Egf
Gene ID (NCBI) 13645
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01132
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epidermal Growth Factor (EGF) is a type of mitogenic factor that stimulates the proliferation of various cells, including epithelial cells and fibroblasts. It is a small peptide composed of 53 amino acids with a molecular weight of approximately 6,000 Daltons. EGF contains three disulfide bonds, which contribute to its stability under acidic and high-temperature conditions. Human EGF is synthesized as transmembrane precursor proteins (1207 amino acids), which are proteolytically cleaved to generate the 54 amino acid mature EGF. EGF plays a crucial role in regulating cell growth, proliferation, and differentiation. When EGF binds to its receptor (EGFR), it activates intracellular signaling pathways that lead to DNA synthesis and cell proliferation. EGF is naturally present in various tissues and body fluids, including saliva, urine, and milk. It is primarily synthesized in the submandibular glands and duodenum.

Protocols

Product Specific Protocols
IF protocol for EGF antibody 84601-1-RRDownload protocol
IHC protocol for EGF antibody 84601-1-RRDownload protocol
WB protocol for EGF antibody 84601-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...