• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EGFR Monoclonal antibody

EGFR Monoclonal Antibody for FC (Intra)
Cat No. CL488-66455
Clone No.2A2H10

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, FC (Intra)

Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGF Receptor , EGF R, 2A2H10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

CL488-66455 targets EGFR in WB, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityrat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24947

Product name: Recombinant human EGFR protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 291-534 aa of BC094761

Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC

Predict reactive species
Full Name epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Calculated Molecular Weight 1210 aa, 134 kDa
Observed Molecular Weight 145-165 kDa
GenBank Accession NumberBC094761
Gene Symbol EGFR
Gene ID (NCBI) 1956
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer.

Publications

SpeciesApplicationTitle
ratWB

J Ethnopharmacol

Mechanisms and synergistic effects of the active components of Xanthocerais lignum in inhibiting rheumatoid arthritis through the modulation of the biological behavior of synovial cells

Authors - Hao Qian
Loading...
||
New chat Able
正在加载,请稍候...