• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EGFR Monoclonal antibody

EGFR Monoclonal Antibody for FC (Intra)
Cat No. CL488-66455
Clone No.2A2H10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGF Receptor , EGF R, 2A2H10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66455 targets EGFR in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24947

Product name: Recombinant human EGFR protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 291-534 aa of BC094761

Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC

Predict reactive species
Full Name epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Calculated Molecular Weight 1210 aa, 134 kDa
Observed Molecular Weight 145-165 kDa
GenBank Accession NumberBC094761
Gene Symbol EGFR
Gene ID (NCBI) 1956
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EGFR antibody CL488-66455Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...