EHBP1L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EHBP1L1 Polyclonal antibody, PBS Only (29383-1-PBS)

• 

  WB analysis of rat testis using 29383-1-AP (same clone as 29383-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 29383-1-AP (EHBP1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29383-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 29383-1-AP (same clone as 29383-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 29383-1-AP (EHBP1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29383-1-PBS in a different storage buffer formulation.

EHBP1L1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29383-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EHBP1L 1

---

Product Information

29383-1-PBS targets EHBP1L1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29796

  Product name: Recombinant human EHBP1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 549-747 aa of NM_001099409

  Sequence: AQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQEKEVEGSGFPETRTLEIEILGALEKEAARSRVLESEVAGTAQCEGLETQETEVGVIETPGTETEVLGTQKTEAGGSGVLQTRTTIAETEVLVTQEISGDLGPLKIEDTIQSEMLGTQETEVEASRVPESEAEGTEAKILGTQEITARDSGVREIEAEIAESD

• Full Name: EH domain binding protein 1-like 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_001099409
• Gene Symbol: EHBP1L1
• Gene ID (NCBI): 254102
• RRID: AB_3742312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3D4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EHBP1L1 is an adapter protein localized on recycling endosomes. It regulates apical-directed transport in polarized epithelial cells. Additionally, EHBP1L1 is crucial for erythroblast enucleation by promoting nuclear polarization in coordination with Rab10, Bin1, and dynamin. It also maintains the proper morphology and structural stability of erythrocytes.