EHD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EHD4 Polyclonal antibody (11382-2-AP)

EHD4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11382-2-AP Copied!

Publications (6)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HCA11, HCA10, FKSG7, EH domain-containing protein 4, EH domain containing protein 4

• 

  WB analysis using 11382-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11382-2-AP (EHD4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 11382-2-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11382-2-AP (EHD4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11382-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11382-2-AP (EHD4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11382-2-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11382-2-AP (EHD4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11382-2-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11382-2-AP (EHD4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11382-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11382-2-AP (EHD4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11382-2-AP

  Immunofluorescent analysis of HepG2 cells, using EHD4 antibody 11382-2-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EHD4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse testis tissue, HeLa cells, HEK-293T cells, HepG2 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11382-2-AP targets EHD4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1942

  Product name: Recombinant human EHD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 335-541 aa of BC006287

  Sequence: ISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD

• Full Name: EH-domain containing 4
• Calculated Molecular Weight: 541 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC006287
• Gene Symbol: EHD4
• Gene ID (NCBI): 30844
• RRID: AB_2277764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H223
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

H-domain containing 4, also known as EHD4, belongs to the EHD protein family. Northern blot analysis detected expression of 4 mRNA species of approximately 2.0, 2.7, 3.2, and 3.6 kb. All of the transcripts are highly expressed in pancreas, and the 2.7- and 3.6-kb transcripts are highly expressed in heart. Only weak expression is found in other tissues.

Publications

What published studies show

The EHD4 Polyclonal antibody (Cat# 11382-2-AP) has 6 citations published in EBioMedicine, J Am Soc Nephrol, Curr Biol, Life Sci, Biomedicines, and Virol Sin. Research fields span reproductive biology (decidualization/Wnt signaling), renal physiology (diabetic glomerular filtration), membrane biology (caveolae), endocrinology (testosterone synthesis), oncology (liver cancer), and virology (Zika virus infection). Cited applications include WB, IHC, and IF across human, mouse, and rat species.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EBioMedicine; EHD1 impairs decidualization by regulating the Wnt4/β-catenin signaling pathway in recurrent implantation failure.; Authors - Quan Zhou
mouse	WB,IHC	J Am Soc Nephrol; Reduced Glomerular Filtration in Diabetes is Attributable to Loss of Density and Increased Resistance of Glomerular Endothelial Cell Fenestrations.; Authors - Natalie Finch
mouse	WB	Curr Biol; EHD Proteins Cooperate to Generate Caveolar Clusters and to Maintain Caveolae during Repeated Mechanical Stress.; Authors - Ivana Yeow
mouse	WB	Life Sci; EHD3 positively regulated by NR5A1 participates in testosterone synthesis via endocytosis.; Authors - Lingling Zhang
rat	WB	Biomedicines; A Comprehensive Study Employing Computational Analysis and Mendelian Randomization Has Revealed the Impact of Key Genes on Liver Cancer; Authors - Size Li
human	IF	Virol Sin; EHD4 facilitates Zika virus infection by regulating extracellular vesicle-associated viral release and cell attachment.; Authors - Yue Zhang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product received a 5-star rating for Western blot applications. The reviewer reported successful use on HEK293T cells at a 1:1000 dilution, confirming reliable performance for detecting the target protein in this cell line.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Kyosuke (Verified Customer) (06-12-2019)

I works well on HEK293T for Western blot.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HEK293T