EHF Monoclonal antibody, PBS Only

• 

  WB analysis of LNCaP using 67125-1-Ig (same clone as 67125-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 67125-1-Ig (same clone as 67125-1-PBS)

  NCCIT cell were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 67125-1-Ig (same clone as 67125-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 67125-1-Ig (same clone as 67125-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 67125-1-Ig (same clone as 67125-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67125-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EHF Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67125-1-PBS

Clone No.1C12E4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

EHF, ESE 3, ESE3, ESE3B, ESEJ, ets homologous factor, hEHF

---

Product Information

67125-1-PBS targets EHF in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28769

  Product name: Recombinant human EHF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-199 aa of BC038995

  Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT

• Full Name: ets homologous factor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC038995
• Gene Symbol: EHF
• Gene ID (NCBI): 26298
• RRID: AB_2882425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZC4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.