EHF Monoclonal antibody

• 

  WB analysis of LNCaP using 67125-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 67125-1-Ig

  NCCIT cell were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of T-47D using 67125-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 67125-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 67125-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 67125-1-Ig (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

EHF Monoclonal Antibody for WB, ELISA

Cat No. 67125-1-Ig

Clone No.1C12E4

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

EHF, ESE 3, ESE3, ESE3B, ESEJ, ets homologous factor, hEHF

---

Tested Applications

• Positive WB detected in: LNCaP cells, human brain tissue, A431 cells, NCCIT cell, T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• IHC: See 1 publications below

Product Information

67125-1-Ig targets EHF in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28769

  Product name: Recombinant human EHF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-199 aa of BC038995

  Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT

• Full Name: ets homologous factor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC038995
• Gene Symbol: EHF
• Gene ID (NCBI): 26298
• RRID: AB_2882425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZC4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Am J Cancer Res; Ese-3 contributes to colon cancer progression by downregulating EHD2 and transactivating INPP4B.; Authors - Junqiang Li ; KD Validated