EHHADH Recombinant monoclonal antibody

EHHADH Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87579-1-RR
Clone No.252944F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

3-hydroxyacyl-CoA dehydrogenase, ECHD, Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase, L PBE, LBFP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, rat kidney tissue, mouse liver tissue, rat liver tissue
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87579-1-RR targets EHHADH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24237

Product name: Recombinant human EHHADH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 108-284 aa of BC038948

Sequence: GCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTP

Predict reactive species
Full Name enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
Calculated Molecular Weight 723 aa, 79 kDa
Observed Molecular Weight 69 kDa
GenBank Accession NumberBC038948
Gene Symbol EHHADH
Gene ID (NCBI) 1962
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08426
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EHHADH, as the "bifunctional catalytic center" of peroxisome fatty acid β-oxidation, its expression and activity directly affect energy metabolism, inflammation level and cell fate. Gene defect causes serious neuro-renal tubular lesions, and abnormal expression is closely related to modern chronic diseases such as obesity, diabetes and tumor, which is one of the hot metabolic enzymes concerned by basic research and clinical transformation. It is mainly located in peroxisome, and some activity can be detected in mitochondrial inner membrane, and it is highly expressed in liver, kidney, heart and other organs.

Protocols

Product Specific Protocols
IHC protocol for EHHADH antibody 87579-1-RRDownload protocol
WB protocol for EHHADH antibody 87579-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...