CoraLite® Plus 488-conjugated EHHADH Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated EHHADH Recombinant monoclonal antibody (CL488-87579)

EHHADH Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-87579

Clone No.252944F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

3-hydroxyacyl-CoA dehydrogenase, ECHD, Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase, L PBE, LBFP

• 

  IF Staining of HepG2 using CL488-87579

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 EHHADH antibody (CL488-87579, Clone: 252944F5 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-87579 targets EHHADH in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24237

  Product name: Recombinant human EHHADH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 108-284 aa of BC038948

  Sequence: GCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTP

• Full Name: enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
• Calculated Molecular Weight: 723 aa, 79 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC038948
• Gene Symbol: EHHADH
• Gene ID (NCBI): 1962
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08426
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

EHHADH, as the "bifunctional catalytic center" of peroxisome fatty acid β-oxidation, its expression and activity directly affect energy metabolism, inflammation level and cell fate. Gene defect causes serious neuro-renal tubular lesions, and abnormal expression is closely related to modern chronic diseases such as obesity, diabetes and tumor, which is one of the hot metabolic enzymes concerned by basic research and clinical transformation. It is mainly located in peroxisome, and some activity can be detected in mitochondrial inner membrane, and it is highly expressed in liver, kidney, heart and other organs.