Home
Products
Primary Antibodies
EIF1 Polyclonal antibody, PBS Only (15276-1-PBS)

Filter: AllWBIPIHC

WB analysis of Jurkat using 15276-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 15276-1-AP (EIF1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 15276-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 15276-1-AP (EIF1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
IP experiment of Jurkat using 15276-1-AP (same clone as 15276-1-PBS)
IP result of anti-EIF1 (IP:15276-1-AP, 4ug; Detection:15276-1-AP 1:600) with Jurkat cells lysate 3440 ug. This data was developed using the same antibody clone with 15276-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 15276-1-AP (same clone as 15276-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15276-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 15276-1-AP (same clone as 15276-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15276-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 15276-1-AP (same clone as 15276-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15276-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 15276-1-AP (same clone as 15276-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15276-1-PBS in a different storage buffer formulation.

EIF1 Polyclonal antibody, PBS Only

Name: EIF1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 15276-1-PBS

EIF1 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 15276-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

15276-1-PBS targets EIF1 in IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7394 Product name: Recombinant human EIF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC005118 Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Predict reactive species
Full Name	eukaryotic translation initiation factor 1
Calculated Molecular Weight	13 kDa
GenBank Accession Number	BC005118
Gene Symbol	EIF1
Gene ID (NCBI)	10209
RRID	AB_2878121
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P41567
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.