• Featured Product
  • KD/KO Validated

EIF2S2 Polyclonal antibody

EIF2S2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10227-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Eukaryotic translation initiation factor 2 subunit 2, eIF2-beta, EIF2beta, EIF2B, EIF2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, mouse testis tissue, mouse liver tissue, L02 cells, HeLa cells, PC-3 cells, HepG2 cells, rat liver tissue, Jurkat cells, NIH/3T3 cells, C6 cells
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman testis tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, L02 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10227-1-AP targets EIF2S2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0269

Product name: Recombinant human EIF2S2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-210 aa of BC000461

Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV

Predict reactive species
Full Name eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC000461
Gene Symbol EIF2S2
Gene ID (NCBI) 8894
RRIDAB_2262043
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20042
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.

Protocols

Product Specific Protocols
WB protocol for EIF2S2 antibody 10227-1-APDownload protocol
IHC protocol for EIF2S2 antibody 10227-1-APDownload protocol
IF protocol for EIF2S2 antibody 10227-1-APDownload protocol
IP protocol for EIF2S2 antibody 10227-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Res

Comparative oncogenomics identifies PSMB4 and SHMT2 as potential cancer driver genes.

Authors - Genee Y Lee
WB

J Transl Med

CAPN2 promotes apalutamide resistance in metastatic hormone-sensitive prostate cancer by activating protective autophagy

Authors - Zihao Qi
humanWB

Front Mol Biosci

Comprehensive Characterization of Ageing-Relevant Subtypes Associated With Different Tumorigenesis and Tumor Microenvironment in Prostate Cancer.

Authors - Liang Huang
  • KD Validated
mouseIF

J Med Genet

Bi-allelic variants in chromatoid body protein TDRD6 cause spermiogenesis defects and severe oligoasthenoteratozoospermia in humans

Authors - Rui Guo
humanWB,IHC

Biomol Ther (Seoul)

Translation Initiation Factor-2S2 (eIF2S2) Contributes to Cervical Carcinogenesis by Inhibiting the TGF-β/SMAD4 Signaling Pathway

Authors - Juthika Kundu
mouseWB

Neurogenetics

Genetic ablation of ataxin-2 increases several global translation factors in their transcript abundance but decreases translation rate.

Authors - M Fittschen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Leos (Verified Customer) (08-05-2022)

eIF2S2 is good for IP and WB, but eIF2S3 is only for WB

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
EIF2S2 Antibody Western Blot,Immunoprecipitation validation (1:1000 dilution) in HEK293T (Cat no:10227-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...