Tested Applications
| Positive WB detected in | HEK-293T cells, mouse testis tissue, mouse liver tissue, L02 cells, HeLa cells, PC-3 cells, HepG2 cells, rat liver tissue, Jurkat cells, NIH/3T3 cells, C6 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10227-1-AP targets EIF2S2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0269 Product name: Recombinant human EIF2S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC000461 Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV Predict reactive species |
| Full Name | eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC000461 |
| Gene Symbol | EIF2S2 |
| Gene ID (NCBI) | 8894 |
| RRID | AB_2262043 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20042 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| IHC protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| IP protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| WB protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-eIF2S2 antibody (Cat# 10227-1-AP) has 13 citations spanning journals including Science, Cancer Research, Journal of Translational Medicine, Neurobiology of Disease, Carcinogenesis, Frontiers in Molecular Biosciences, Biomolecular Therapeutics, European Journal of Medical Research, Frontiers in Bioscience, Journal of Medical Genetics, Gastro Hep Advances, Neurogenetics, and Fly. Research fields cover cancer (prostate, cervical, pancreatic, gastric, OSCC), neurodegeneration (FXTAS, spinocerebellar ataxia), integrated stress response/translation regulation, and spermiogenesis defects.
| Species | Application | Title |
|---|---|---|
Cancer Res Comparative oncogenomics identifies PSMB4 and SHMT2 as potential cancer driver genes. | ||
J Transl Med CAPN2 promotes apalutamide resistance in metastatic hormone-sensitive prostate cancer by activating protective autophagy | ||
Neurobiol Dis Dissecting the roles of EIF4G homologs reveals DAP5 as a modifier of CGG repeat-associated toxicity in a Drosophila model of FXTAS
| ||
Biomol Ther (Seoul) Translation Initiation Factor-2S2 (eIF2S2) Contributes to Cervical Carcinogenesis by Inhibiting the TGF-β/SMAD4 Signaling Pathway | ||
Eur J Med Res Investigating the potential role of EIF2S2 in OSCC progression through comprehensive bioinformatics analysis and experimental validation |
Reviews
What customers say
One reviewer (5/5) used this antibody at a 1:1000 dilution on HEK293T cells for Western Blot and Immunoprecipitation. They reported that the antibody works well for both IP and WB when targeting eIF2S2, but noted that for eIF2S3 it performs only in WB, not IP. Overall, the user was satisfied with the product's performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Leos (Verified Customer) (08-05-2022) | eIF2S2 is good for IP and WB, but eIF2S3 is only for WB
 |
