EIF3C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EIF3C Polyclonal antibody, PBS Only (12733-1-PBS)

• 

  WB analysis of K-562 using 12733-1-AP (same clone as 12733-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12733-1-AP (EIF3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12733-1-AP (same clone as 12733-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12733-1-AP (EIF3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 12733-1-AP (same clone as 12733-1-PBS)

  IP result of anti-EIF3C (IP:12733-1-AP, 4ug; Detection:12733-1-AP 1:500) with K-562 cells lysate 3200ug. This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12733-1-AP (same clone as 12733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12733-1-AP (EIF3C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 12733-1-AP (same clone as 12733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 12733-1-AP (EIF3C antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12733-1-AP (same clone as 12733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12733-1-AP (EIF3C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12733-1-PBS in a different storage buffer formulation.

EIF3C Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12733-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12733-1-PBS targets EIF3C in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3438

  Product name: Recombinant human EIF3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC001571

  Sequence: MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEI

• Full Name: eukaryotic translation initiation factor 3, subunit C
• Calculated Molecular Weight: 913 aa, 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC001571
• Gene Symbol: EIF3C
• Gene ID (NCBI): 8663
• RRID: AB_2096747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99613
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.