EIF3E Monoclonal antibody

• 

  WB analysis using 67095-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67095-1-Ig (EIF3E antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IP experiment of HeLa using 67095-1-Ig

  IP result of anti-EIF3E (IP:67095-1-Ig, 5ug; Detection:67095-1-Ig 1:2000) with HeLa cells lysate 1600 ug.

• 

  IF Staining of HepG2 using 67095-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF3E antibody (67095-1-Ig, Clone: 1C6C8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

EIF3E Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 67095-1-Ig

Clone No.1C6C8

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, RIP, ELISA

Synonyms

1C6C8, eIF-3 p48, EIF3S6, INT6, Viral integration site protein INT-6 homolog

---

Tested Applications

• Positive WB detected in: U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• RIP: See 1 publications below

Product Information

67095-1-Ig targets EIF3E in WB, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28523

  Product name: Recombinant human EIF3E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 146-445 aa of BC000734

  Sequence: GAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

• Full Name: eukaryotic translation initiation factor 3, subunit E
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC000734
• Gene Symbol: EIF3E
• Gene ID (NCBI): 3646
• RRID: AB_2882400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P60228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	RIP	Cancer Res; Extracellular Vesicles Containing circMYBL1 Induce CD44 in Adenoid Cystic Carcinoma Cells and Pulmonary Endothelial Cells to Promote Lung Metastasis; Authors - Min Fu