EIF3E Monoclonal antibody, PBS Only

• 

  WB analysis using 67095-1-Ig (same clone as 67095-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67095-1-Ig (EIF3E antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67095-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 67095-1-Ig (same clone as 67095-1-PBS)

  IP result of anti-EIF3E (IP:67095-1-Ig, 5ug; Detection:67095-1-Ig 1:2000) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 67095-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67095-1-Ig (same clone as 67095-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF3E antibody (67095-1-Ig, Clone: 1C6C8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67095-1-PBS in a different storage buffer formulation.

EIF3E Monoclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 67095-1-PBS

Clone No.1C6C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

1C6C8, eIF-3 p48, EIF3S6, INT6, Viral integration site protein INT-6 homolog

---

Product Information

67095-1-PBS targets EIF3E in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28523

  Product name: Recombinant human EIF3E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 146-445 aa of BC000734

  Sequence: GAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

• Full Name: eukaryotic translation initiation factor 3, subunit E
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC000734
• Gene Symbol: EIF3E
• Gene ID (NCBI): 3646
• RRID: AB_2882400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P60228
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.