EIF3K Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF3K Polyclonal antibody (10640-1-AP)

EIF3K Polyclonal Antibody for WB, ELISA

Cat No. 10640-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ARG134, eIF 3 p25, eIF 3 p28, EIF3 p28, EIF3K, EIF3S12, HSPC029, M9, MSTP001, PLAC 24, PLAC24, PRO1474, PTD001

• 

  WB analysis using 10640-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10640-1-AP (EIF3K antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF3K in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NCI-H1299 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10640-1-AP targets EIF3K in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1000

  Product name: Recombinant human EIF3K protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC007559

  Sequence: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

• Full Name: eukaryotic translation initiation factor 3, subunit K
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: BC007559
• Gene Symbol: EIF3K
• Gene ID (NCBI): 27335
• RRID: AB_2262100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBQ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EIF3K Polyclonal antibody (Cat# 10640-1-AP) has 2 citations. One appears in Nature Communications (2020), studying a translational program that suppresses metabolism to shield the genome, and the other in Environmental Toxicology (2021), investigating how SMAR1 attenuates osteosarcoma stemness by suppressing ABCG2 transcriptional activity. Both citations used the antibody for Western Blot in human samples, covering research fields in molecular biology and cancer biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; A translational program that suppresses metabolism to shield the genome.; Authors - Nathan C Balukoff
human	WB	Environ Toxicol; SMAR1 attenuates the stemness of osteosarcoma cells via through suppressing ABCG2 transcriptional activity.; Authors - Hongyu Xu