EIF4E2 Polyclonal antibody

• 

  WB analysis of HeLa using 12227-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12227-1-AP (EIF4E2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 12227-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12227-1-AP (EIF4E2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12227-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12227-1-AP (EIF4E2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12227-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12227-1-AP (EIF4E2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12227-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12227-1-AP (EIF4E2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 12227-1-AP

  IP result of anti-EIF4E2 (IP:12227-1-AP, 4ug; Detection:12227-1-AP 1:500) with MCF-7 cells lysate 1280ug.

• 

  IHC staining of human breast cancer using 12227-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12227-1-AP (EIF4E2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cervical cancer using 12227-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 12227-1-AP (EIF4E2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 12227-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 12227-1-AP (EIF4E2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 12227-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12227-1-AP (EIF4E2 Antibody) at dilution of 1:50 (under 10x lens).

EIF4E2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12227-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, RIP, IHC, ELISA

Synonyms

4E LP, 4EHP, eIF 4E type 2, eIF4E like protein 4E LP, eIF4E type 2, EIF4E2, EIF4EL3, IF4e, mRNA cap binding protein 4EHP

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, mouse kidney tissue
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• RIP: See 1 publications below

Product Information

12227-1-AP targets EIF4E2 in WB, IP, RIP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2864

  Product name: Recombinant human EIF4E2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-245 aa of BC021690

  Sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

• Full Name: eukaryotic translation initiation factor 4E family member 2
• Calculated Molecular Weight: 245 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC021690
• Gene Symbol: EIF4E2
• Gene ID (NCBI): 9470
• RRID: AB_10642945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60573
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis; Authors - Ji Geng
human	WB,RIP	Cell Death Dis; α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation; Authors - Hao Wang
human	WB	iScience; The SARS-CoV-2 protein NSP2 impairs the silencing capacity of the human 4EHP-GIGYF2 complex.; Authors - Limei Zou
human	WB,IHC	Eur J Med Res; N7-methylguanosin regulators-mediated methylation modification patterns and characterization of the immune microenvironment in lower-grade glioma; Authors - Aierpati Maimaiti
human	WB	Nat Struct Mol Biol; Isoform-resolved mRNA profiling of ribosome load defines interplay of HIF and mTOR dysregulation in kidney cancer; Authors - Yoichiro Sugimoto