EIF4EBP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EIF4EBP2 Polyclonal antibody, PBS Only (15628-1-PBS)

• 

  WB analysis using 15628-1-AP (same clone as 15628-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15628-1-AP (EIF4EBP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15628-1-PBS in a different storage buffer formulation.

EIF4EBP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15628-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Eukaryotic translation initiation factor 4E-binding protein 2, eIF4E-binding protein 2, eIF4E binding protein 2, 4E-BP2, 4EBP2

---

Product Information

15628-1-PBS targets EIF4EBP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8101

  Product name: Recombinant human EIF4EBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC005057

  Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

• Full Name: eukaryotic translation initiation factor 4E binding protein 2
• Calculated Molecular Weight: 120 aa, 13 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC005057
• Gene Symbol: EIF4EBP2
• Gene ID (NCBI): 1979
• RRID: AB_3669215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13542
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EIF4EBP2(Eukaryotic translation initiation factor 4E-binding protein 2), also named as 4EBP2, is a member of the eukaryotic translation initiation factor 4E binding protein family. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation. EIF4EBP2 is a repressor of translation initiation involved in synaptic plasticity, learning and memory formation (PubMed:30765518).