EIF5A2 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67907-1-Ig (same clone as 67907-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67907-1-Ig (EIF5A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67907-1-Ig (same clone as 67907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67907-1-Ig (EIF5A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67907-1-Ig (same clone as 67907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67907-1-Ig (EIF5A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67907-1-Ig (same clone as 67907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67907-1-Ig (EIF5A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67907-1-Ig (same clone as 67907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67907-1-Ig (EIF5A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67907-1-Ig (same clone as 67907-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using EIF5A2 antibody (67907-1-Ig, Clone: 1F9B2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67907-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51726-1

  Cytometric bead array sample test of MP51726-1, EIF5A2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67907-1-PBS. Detection antibody: 67907-2-PBS.

• 

  Cytometric bead array standard curve of MP51726-1

  Cytometric bead array standard curve of MP51726-1, EIF5A2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67907-1-PBS. Detection antibody: 67907-2-PBS. Standard:Ag10852. Range: 0.781-100 ng/mL.

EIF5A2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67907-1-PBS

Clone No.1F9B2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EIF5A1/EIF5A2, 1F9B2, EIF 5A2, eIF-5A2, eIF-5A-2

---

Product Information

67907-1-PBS targets EIF5A2 as part of a matched antibody pair:

MP51726-1: 67907-1-PBS capture and 67907-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10852

  Product name: Recombinant human EIF5A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-153 aa of BC036072

  Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

• Full Name: eukaryotic translation initiation factor 5A2
• Calculated Molecular Weight: 153 aa, 17 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC036072
• Gene Symbol: EIF5A2
• Gene ID (NCBI): 56648
• RRID: AB_2918663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9GZV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Eukaryotic translation initiation factor 5A (EIF5A), a conserved lysine to hypusine, is strictly indispensable for the survival of eukaryotic cells. There are two EIF5A isoforms in humans: EIF5A1 and EIF5A2. EIF5A2 has been reported to be overexpressed in gallbladder cancer, upper urinary tract urothelial carcinoma, gastric cancer, prostate cancer, nasopharyngeal carcinoma, and cervical cancer. EIF5A2 upregulation in cancer tissues is associated with poor prognosis in these patients.