ELK1 Polyclonal antibody

• 

  WB analysis using 27420-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27420-1-AP (ELK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27420-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27420-1-AP (ELK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27420-1-AP

  WB result of ELK1 antibody (27420-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ELK1 transfected HepG2 cells.

• Featured Product
• KD/KO Validated

ELK1 Polyclonal Antibody for WB, ELISA

Cat No. 27420-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

ELK , ELK1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• ChIP: See 1 publications below

Product Information

27420-1-AP targets ELK1 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26683

  Product name: Recombinant human ELK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-320 aa of BC056150

  Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE

• Full Name: ELK1, member of ETS oncogene family
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC056150
• Gene Symbol: ELK1
• Gene ID (NCBI): 2002
• RRID: AB_2880867
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19419
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Clin Invest; Cancer-associated fibroblast-secreted glucosamine alters the androgen biosynthesis program in prostate cancer via HSD3B1 upregulation; Authors - Di Cui
human	WB	Front Oncol; tRNA-Derived Fragment tRF-Glu-TTC-027 Regulates the Progression of Gastric Carcinoma via MAPK Signaling Pathway; Authors - Weiguo Xu
rat	IHC	J Transl Med; The SETD8/ELK1/bach1 complex regulates hyperglycaemia-mediated EndMT in diabetic nephropathy.; Authors - Xue Li
human	WB	Biochem Biophys Res Commun; CircRNA circ-0038718 promotes hepatocellular carcinoma progression through sponging miR-139-3p.; Authors - Ranran Sun
human	WB	Genes Genomics; Tumor-suppressive miRNA-135a inhibits breast cancer cell proliferation by targeting ELK1 and ELK3 oncogenes.; Authors - Akhlaq Ahmad ; KD Validated
human	WB	Cancer Res Commun; Adaptive c-Met-PLXDC2 Signaling Axis Mediates Cancer Stem Cell Plasticity to Confer Radioresistance-associated Aggressiveness in Head and Neck Cancer; Authors - Liwei Lang ; KD Validated