ELK1 Recombinant monoclonal antibody

• 

  WB analysis using 87009-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87009-2-RR (ELK1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 87009-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ELK1 antibody (87009-2-RR, Clone: 252085B2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 87009-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87009-2-RR against Human ELK1 were performed. The affinity constant is 10.0 nM.

ELK1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87009-2-RR

Clone No.252085B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ELK, ELK 1, ETS domain-containing protein Elk-1

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells, Jurkat cells, Raji cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87009-2-RR targets ELK1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26683

  Product name: Recombinant human ELK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-320 aa of BC056150

  Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE

• Full Name: ELK1, member of ETS oncogene family
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 58-60 kDa
• GenBank Accession Number: BC056150
• Gene Symbol: ELK1
• Gene ID (NCBI): 2002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19419
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELK1 is a nuclear transcription factor of the ETS-domain family and the ternary complex factor (TCF) sub-family. It binds to purine-rich DNA sequences and forms a ternary complex with serum response factor (SRF) on the serum response element (SRE) located in the promoter regions of immediate early genes such as FOS and IER2. Upon activation of the JNK or MAPK/ERK signaling cascades, ELK1 is phosphorylated and rapidly induces target-gene transcription, thereby regulating cell proliferation, differentiation, and survival.