ELL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ELL2 Polyclonal antibody, PBS Only (12727-1-PBS)

• 

  WB analysis using 12727-1-AP (same clone as 12727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12727-1-AP (ELL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12727-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12727-1-AP (same clone as 12727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12727-1-AP (ELL2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12727-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12727-1-AP (same clone as 12727-1-PBS)

  IP result of anti-ELL2 (IP:12727-1-AP, 4ug; Detection:12727-1-AP 1:300) with mouse brain tissue lysate 3440ug. This data was developed using the same antibody clone with 12727-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ELL2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 12727-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

ELL 2

---

Product Information

12727-1-PBS targets ELL2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3428

  Product name: Recombinant human ELL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-640 aa of BC028412

  Sequence: TNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS

• Full Name: elongation factor, RNA polymerase II, 2
• Calculated Molecular Weight: 640 aa, 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC028412
• Gene Symbol: ELL2
• Gene ID (NCBI): 22936
• RRID: AB_10644131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00472
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998).