ELL2 Polyclonal antibody

• 

  WB analysis using 32800-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32800-1-AP (ELL2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 32800-1-AP

  WB result of ELL2 antibody (32800-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ELL2 transfected HeLa cells.

• Featured Product
• KD/KO Validated

ELL2 Polyclonal Antibody for WB, ELISA

Cat No. 32800-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ELL 2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32800-1-AP targets ELL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39224

  Product name: Recombinant human ELL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 393-515 aa of BC028412

  Sequence: NSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCT

• Full Name: elongation factor, RNA polymerase II, 2
• Calculated Molecular Weight: 640 aa, 72 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC028412
• Gene Symbol: ELL2
• Gene ID (NCBI): 22936
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00472
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998). The predicted molecular weight of the ELL2 protein is 72 kDa, but due to post-translational modifications, its molecular weight is approximately 90 kDa. (PMID: 39582094, PMID: 34948391)