ELMO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ELMO1 Polyclonal antibody (26974-1-AP)

ELMO1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26974-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ELMO 1, engulfment and cell motility 1

• 

  WB analysis using 26974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26974-1-AP (ELMO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 26974-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26974-1-AP (ELMO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 26974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26974-1-AP (ELMO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 26974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26974-1-AP (ELMO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 26974-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ELMO1 antibody (26974-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of K-562 using 26974-1-AP

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using ELMO1 antibody (26974-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse spleen tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: K-562 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26974-1-AP targets ELMO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25635

  Product name: Recombinant human ELMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-158 aa of BC114341

  Sequence: RLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFT

• Full Name: engulfment and cell motility 1
• Observed Molecular Weight: 80~84 kDa
• GenBank Accession Number: BC114341
• Gene Symbol: ELMO1
• Gene ID (NCBI): 9844
• RRID: AB_3742207
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92556
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELMO1 (Engulfment and cell motility protein 1) is a cytoplasmic adapter protein that physically associates with members of the Dock-A family of Rac-GEFs, of which Dock1 and Dock2 are the best characterized (PMID: 24821968). ELMO1 is expressed in platelets and negatively regulates integrin-mediated platelet spreading. Upregulated ELMO1 expression is associated with a poor prognosis in hepatocellular carcinoma (HCC), as well as increased cell growth, invasion, migration, angiogenesis and EMT in vitro and in vivo (PMID: 31324602).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; Unveiling key genes for intervertebral disc degeneration prediction and potential drug discovery.; Authors - Tian-jie Li